Categories
Easy Mold 1: 1 RTV Silicone Putty for Mini Mold Making
Silicone Putty/Mini silicone mold DIY Resin Mold/MC silicone Product DescriptionMC-SiliconePUTTYarenewsiliconecompounds(platinumcatalyst)thatcanbeeasilymixedandappliedbyhandtoavarietyofsurfaces.SiliconePuttyismixedinequalamounts(1A:1B)byvolume/weight.MC-P35hasapotlifeofabout5-20minutewithacuretimeof
Related Products: Silicone Putty manufacturer , Putty Silicone manufacturer , Mini Silicone DIY manufacturer ,
English name: 1-Chloro-2, 4-Dinitrobenzene; 2, 4-Dinitrochlorobenzeue Molecular formula: C6H3ClN2O4 Molecule weight: 202.55 CAS No: 97-00-7 Description of the product: The product is made up from p-Nitrocholobenzene by adopting the process of nitration and decontamination and is a yellow needle
Related Products: 2 4-Dinitrochlorobenzene manufacturer ,
High Quality Light Burning Magnesium Briquette Machine
Gongyi Hengchang Metallurgy Building Material Equipments plant was established in 1992, is a professional manufacturer of complete set mineral beneficiation equipments, sand and stone crushing equipments, Briquetting equipments, coal preparation equipments, drying and calcine equipments, cement plan
Related Products: Light Burning Magnesium Briquette Machine manufacturer , Magnesium Briquette Machine manufacturer , Magnesium Powder Briquette Machine manufacturer ,
3.2mm Low-E Float Glass with CE&ISO9001
Production Process:Low-E glass is also called Low radiation coated glass; it is one kind of special glass which coated with multilayer of very low surface radiation rate of metal or other compounds. Low-E glass is a kind of green, energy-saving, environmental friendly glass products. Normal glass su
Related Products: Low-E Glass manufacturer , Low-E Insulated Glass manufacturer , Low-E Coated Glass manufacturer ,
Model NO.:powderType:Fumaric AcidAppearance:White Crystal PowderAssay:99.5%-100.5%Additional Info.Trademark:OSPacking:25kg Woven BagStandard:SGSOrigin:Tianjin ChinaProduction Capacity:60000 Metric Ton/Per YearProduct DescriptionSpecificationsFumaric acid plays an important role in bacteriostasis and
Related Products: Fumaric Acid manufacturer ,
Nitric Acid Plant ISO Certified
Identifiers:1. Nitric acid2. Purity: 68% 98%3. Best quality and competitive price4. Professional service5. SGS supportNitric Acid1. Best valuable2. Direct factory3. Quality assured4. Professional serviceProperties: Nitric acid is an important starting material for the production of fertilizers and c
Related Products: Nitric Acid 68% manufacturer ,Price of Nitric Acid manufacturer ,Nitric Acid Plant manufacturer ,
for Flexo Printing Ink, Polyamide Resin Dimer Acid
Dimer Acid1. We are professional manufacturer of dimer acid. Dimer acid and amine will react to produce much different molecular weight polyamide resin. Mainly used to make graver or flexo printing ink, epoxy paint, the curing agent and the epoxy cementing material, lubricant. Dimer acid is used to
Related Products: Dimer Acid manufacturer ,Acid manufacturer ,Epoxy Paint Acid manufacturer ,
Custom Precision Combination Bearing
The highest tolerance for metal parts will be in ± 0.005mm. The highest tolerance for plastic Parts will be in ± 0.01mm. Approved by ISO9001&ISO-TS16949 Production process: The first, saw the workblank by sawing machine, after that, process the inside hole and cut the outside to sp
Related Products: Combination Bearing manufacturer , Combined Bearing manufacturer , Compound Bearing manufacturer ,
Aluminum CNC turning part 1) Material: Stainless steel: SUS303, SUS304, SUS316, SUS316L, SUS430, SUS440, etc Aluminum: 6061-T6, 6063-T5, 7075-T6, 2011, 2017, 2024, 5052, 5083, 6082 etc Brass: C11000, C10200, C12000, C26000, C36000, etc Carbon steel: 1010, 1015, 1020, 1025, 1030, 1035, 1040, 1045, e
Related Products: Cnc Machining manufacturer , Cnc Turning manufacturer , Cnc Machined Parts manufacturer ,
Cork coaster coaster set * Material: EVA compound PP/ pulp/ cork/ MDF/ cork compound MDF/ cork compound paper/ soft PVC/ felt/ tin compound cork/ silicone/ metal, etc. * Color: Can be customized * Size: 90χ 90mm/ dia90mm, 3mm thickness * Logo: CMYK logo printing * Packing: Poly bag/ artpaper b
Related Products: Cork Coaster Set manufacturer ,Cork Coaster manufacturer ,Paper and Cork Coaster manufacturer ,
Acai Professional Salon Berry Essence OPC Amino Acid Shinning Repair Hair Spray
1. Product Name: ACAI Berry Herbal Essence Hair Repairing Spray 2. Ingredient: Natural OPC, 19 kinds of Amino Acids, Essential Fatty Acids, polyphenolic and flavonoid compounds and so on; 3. Products Efficacy: This products contains rich Acai berry essence, which can quickly penetrate into the in
Related Products: Keratin Hair Treatment manufacturer , Spa Product manufacturer , Hair Conditioner manufacturer ,
Lowe E Laminated Insulated Glass/Safety Glass
Qingdao Globalstar Glass Co., Ltd. is located at Qingdao city in North China, as the glass manufacturer and supplier, we are dealing with various kinds of glass and mirror.Our well-known "GLOBALSTAR" brand has been supplied to the market of Europe, America, Middle East, Africa, South Asia and South
Related Products: Low E Glass manufacturer ,Low Emissivity Glass manufacturer ,Low-E Glass manufacturer ,
Fluoroboric Acid Molecular Formula: HBF4 Molecular Weight: 87.81 CAS No.: 16872-11-0 Property: Colorless and transparent liquid; Highly acidic; Capable of being mixed with water and alcohol; Hydrolyzed in water and decomposed when heated to 130° C; Toxic and highly corrosive. Assay: 40% 45% 50%
Related Products: Fluoroboric Acid manufacturer ,16872-11-0 manufacturer ,
85% Phosphoric Acid for Food Additives
Phosphoric Acidfood gradeMolecular Formula: H3PO4Molecular weight:97.99Content: 85% min.Density: 1.6850 ( under 25C)Properties:It is Colorless, transparent and syrupy liquid; It is odorless and tastes very sour; its melting point is 42.35 ; it is easily soluble in water and resolves in ethanol; it m
Related Products: Phosphoric Acid Food Grade manufacturer , PA manufacturer , Phosphoric Acid 85% manufacturer ,
Chrome Free Lignosulfonate-Thinner/ Disperant
ChromeFreeLignosulfonatehasbeenwidelyusedindrillingfluidasthinner/disperantwithit'spropertiesofhightemperatureresistanceat150ºC,non-toxicandanti-electrolytesperformance.ItiscompatiblewithotheradmixtureagentsthussuitableappliedtotheallkindsofWBM.It'sChromiumheavymetalfreecharactermakesitenvironm
Related Products: Chrome Free Lignosulfonate manufacturer , Thinner manufacturer , Rheological Additive manufacturer ,
Product Name: Hydrobromic acid English Name: Hgdrobrmic acid Molecular formula: HBr Molecular weight: 80.91 Physical & chemical properties: Colorless or slight yellow transparent liquid. If placed in the sun or aerated for long, the product will release bromine and be darkened in color. The hydrob
Related Products: Hydrobromic Acid manufacturer ,Acid manufacturer ,Hbr manufacturer ,
CAS No.: 108-24-7 MF: C4H6O3 Purity: 99% & 99.5% Grade Standard: Industrial Grade Packaging & Delivery Packaging Detail: Plastic woven bag or kraft paper bag inner with plastic bag, 200 kgs /drum, 18 mts in the 20 FCL or as you request Delivery Detail after receive the payment or L/C within 25days
Related Products: Carboxylic Acid manufacturer ,Glacial Acetic Acid manufacturer ,Acids manufacturer ,
Ethyl 3-pyridylacetate [CAS NO]: 39931-77-6 [Product Code]: SPY09 [Molecular Formula]: C9H11NO2 [Molecular Weight]: 165.191 [Purity]: 98.0% [Physical Properties]: Colorless or light yellow liquid. Usage: It is the intermediate of Fungicides pyrifenox
Related Products: PYRIDINE manufacturer ,intermediate manufacturer ,derivative manufacturer ,
1. Phosphoric acid food grade 2. Food grade 3. Industry grade 4. CAS No.: 7664-38-2 5. Content: 85% min&75% min 6. Molecular Formula: H3PO4 7. Molecular Weight: 97.99 Item Food Grade Colority ≤ 20 Content (H 3 P O 4 ), % ≥ 75.0~86.0% Chloride(Cl ), % ≤ Sulphates( SO 4 ), % ≤ Iron(Fe), %
Related Products: Phosphoric Acid manufacturer ,H3po4 manufacturer ,Acid manufacturer ,
Industrial Grade Anhydrous Sodium Metasilicate for Printing & Dyeing
Anhydrous sodium metasilicateAnhydrous sodium metasilicate (granular)RTECS Number: VV9275000UN Number: 1759Specifications: Conforms Q / PL005-2000Packing: 25 KG plastic woven bagsFeatures&Performances1. Appearance: white or light gray granular crystal square2. Property: m.p. 40 to 48 ° C, the re
Related Products: Sodium Silicate manufacturer , Sodium Metasilicate manufacturer , Sodium manufacturer ,Manufacturers Directory | Hot Products | China Products | Companies List| Resources Directory | News | Sitemap | Disclaimer | About Us | Contact Us | Cautop|
Copyright 2003-2024 China Manufacturer Directory.